All products sold for research use only — not for human or veterinary consumption.
0
GLP-1 lyophilized peptide vial

GLP / Incretin Analogs

GLP-1 (7-37)

RESEARCH USE ONLY — All compounds offered by SilverZone Labs are intended exclusively for in vitro research and laboratory use. They are not drugs, food, cosmetics, or supplements, and are not intended for human or veterinary consumption. By purchasing, you acknowledge that products will be used solely for research purposes by qualified professionals.

GLP-1 (7-37)

$65.00

Formula: C₁₄₉H₂₂₆N₄₀O₄₅
MW: 3297.68 g/mol
Purity: ≥99.1%
Fill: 3 mg
Form: Lyophilized powder

SKU: AXIS-GLP1-3MG Category:
Molecular formula C₁₄₉H₂₂₆N₄₀O₄₅
Molecular weight 3297.68 g/mol
Purity ≥99.1%
Fill 3 mg
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

COA available on request — contact the lab.

$65.00

Glucagon-like peptide-1, 7-37 amide form. 31-amino-acid incretin reference peptide. Supplied as lyophilized powder, vacuum-sealed in amber-glass vial. For laboratory and analytical use only.

SKU: AXIS-GLP1-3MG Category:

Related products

    Semaglutide
    GLP / Incretin Analogs

    Semaglutide

    Formula: C₁₈₇H₂₉₁N₄₅O₅₉
    MW: 4113.58 g/mol
    RUO · Not for human consumption
    $89.00 Purity ≥99.0%
    Add to cart

RESEARCH USE ONLY — All compounds offered by SilverZone Labs are intended exclusively for in vitro research and laboratory use. They are not drugs, food, cosmetics, or supplements, and are not intended for human or veterinary consumption. By purchasing, you acknowledge that products will be used solely for research purposes by qualified professionals.

Scroll to Top