All products sold for research use only — not for human or veterinary consumption.
0
LL-37

Immune Research

LL-37

RESEARCH USE ONLY — All compounds offered by SilverZone Labs are intended exclusively for in vitro research and laboratory use. They are not drugs, food, cosmetics, or supplements, and are not intended for human or veterinary consumption. Products are not intended to diagnose, treat, cure, or prevent any disease. By purchasing, you acknowledge that products will be used solely for research purposes by qualified professionals.

LL-37

$140.00

Formula: C₂₀₅H₃₄₀N₆₀O₅₃
MW: 4493.33
Purity: ≥99.0%
Fill: 5 mg
Form: Lyophilized powder

SKU: AXIS-LL37-5MG Category:
Molecular formula C₂₀₅H₃₄₀N₆₀O₅₃
Molecular weight 4493.33 g/mol
Purity ≥99.0%
Fill 5 mg
Sequence [LL-37, 37 aa]

COA available on request — contact the lab.

RUO · Not for human consumption
$140.00

Cathelicidin Antimicrobial Peptide. 37-amino-acid C-terminal fragment of human cathelicidin hCAP-18. Supplied as lyophilized powder. For laboratory and analytical use only.

SKU: AXIS-LL37-5MG Category:

Related products

    Thymosin Alpha-1
    Immune Research

    Thymosin Alpha-1

    Formula: C₁₂₉H₂₁₅N₃₃O₅₅
    MW: 3108.30 g/mol
    RUO · Not for human consumption
    $230.00 Purity ≥99.0%
    Add to cart

RESEARCH USE ONLY — All compounds offered by SilverZone Labs are intended exclusively for in vitro research and laboratory use. They are not drugs, food, cosmetics, or supplements, and are not intended for human or veterinary consumption. Products are not intended to diagnose, treat, cure, or prevent any disease. By purchasing, you acknowledge that products will be used solely for research purposes by qualified professionals.

Scroll to Top